Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX)

This Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q31WA9

Expression Region

1-67

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAAO inhibitor-1 1mg
A20117-1 1 mg

DAAO inhibitor-1 1mg

Sign In for Pricing
View Details
TBC1D28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2341805 3x 1.0 µg

TBC1D28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DCAMKL1 Lentiviral Activation Particles (m)
sc-419956-LAC 200 µL

DCAMKL1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Oncostatin M/Osm Rabbit Polyclonal Antibody (HRP)
orb2610860 100 µg

Oncostatin M/Osm Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
POT1 Rabbit Polyclonal Antibody (BF488)
orb2399732 100 µL

POT1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Thyroglobulin Antibody
orb2637952 100 µg

Thyroglobulin Antibody

Sign In for Pricing
View Details