Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX)

This Recombinant Shigella boydii serotype 4 Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q31WA9

Expression Region

1-67

Origin

Shigella boydii serotype 4 (strain Sb227)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prkcz, NT (Prkcz, Pkcz, Protein kinase C zeta type, nPKC-zeta) (MaxLight 405) discontinued
040454-ML405 100 µL

Prkcz, NT (Prkcz, Pkcz, Protein kinase C zeta type, nPKC-zeta) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human Complement Component 7 (C7) ELISA Kit
EKU03413 96 Tests

Human Complement Component 7 (C7) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CD45 Antibody (101) [DyLight 350]
NBP2-89218UV 0.1 mL

Rabbit Monoclonal CD45 Antibody (101) [DyLight 350]

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)
MBS1188877-01 0.02 mg (E-Coli)

Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)
MBS1188877-02 0.02 mg (Yeast)

Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)
MBS1188877-03 0.1 mg (E-Coli)

Recombinant Erwinia tasmaniensis UPF0255 protein ETA_25970 (ETA_25970)

Sign In for Pricing
View Details