Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Uncharacterized protein YIL134C-A (YIL134C-A)

This Recombinant Saccharomyces cerevisiae Uncharacterized protein YIL134C-A (YIL134C-A) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Uncharacterized protein YIL134C-A

UniProt

Q45U18

Expression Region

1-67

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVGSEFNNTADVDVVAILLTLLNADYFVIKQRLVSACFTKRIKWYFIYAIALLSLFSSR NTVCAPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-100 1x 100 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF568 conjugate, 0.1mg/mL
BNC681424-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF568 conjugate, 0.1mg/mL
BNC681386-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL
BNC402953-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF405S conjugate, 0.1mg/mL
BNC040641-100 1x 100 µL

Chromogranin A (LK2H10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF740 conjugate, 0.1mg/mL
BNC741788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details