Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella choleraesuis Protein AaeX (aaeX)

This Recombinant Salmonella choleraesuis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q57JA2

Expression Region

1-67

Origin

Salmonella choleraesuis (strain SC-B67)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit
MBS9941165-01 48 Well

Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit

Sign In for Pricing
View Details
Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit
MBS9941165-02 96 Well

Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit

Sign In for Pricing
View Details
Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit
MBS9941165-03 5x 96 Well

Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit

Sign In for Pricing
View Details
Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit
MBS9941165-04 10x 96 Well

Horse Protein Tyrosine Phosphatase Receptor Type A (PTPRA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal GPR10 Antibody
NLS3915 0.05 mL

Rabbit Polyclonal GPR10 Antibody

Sign In for Pricing
View Details
Cited1 (NM_172055) Rat Tagged ORF Clone
RR209098 10 µg

Cited1 (NM_172055) Rat Tagged ORF Clone

Sign In for Pricing
View Details