Recombinant Salmonella choleraesuis Protein AaeX (aaeX)
This Recombinant Salmonella choleraesuis Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.
Product Specifications
Product Name Alternative
Protein AaeX
UniProt
Q57JA2
Expression Region
1-67
Origin
Salmonella choleraesuis (strain SC-B67)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6380513-01 0.1 mL
GTF2B (TF2B, TFIIB, Transcription Initiation Factor IIB, General Transcription Factor TFIIB, S300-II) (MaxLight 550)
Sign In for Pricing
View Details MBS6380513-02 5x 0.1 mL
GTF2B (TF2B, TFIIB, Transcription Initiation Factor IIB, General Transcription Factor TFIIB, S300-II) (MaxLight 550)
Sign In for Pricing
View Details 