Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q5PJT7

Expression Region

1-67

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PAX8 Antibody (PAX8/8651R) [mFluor Violet 450 SE]
NBP3-24170MFV450 0.1 mL

Rabbit Monoclonal PAX8 Antibody (PAX8/8651R) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
RGD1562351 CRISPRa sgRNA lentivector (set of three targets)(Rat)
39281126 3x 1.0µg DNA

RGD1562351 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Methyl 2-hydroxy-3- (2-methylprop-2-en-1-yl) benzoate
SDA84795-01 100 mg

Methyl 2-hydroxy-3- (2-methylprop-2-en-1-yl) benzoate

Sign In for Pricing
View Details
Methyl 2-hydroxy-3- (2-methylprop-2-en-1-yl) benzoate
SDA84795-02 1 g

Methyl 2-hydroxy-3- (2-methylprop-2-en-1-yl) benzoate

Sign In for Pricing
View Details
Anti-SKAR/POLDIP3 Antibody Picoband® Cy3 Conjugated
A02748-2-Cy3 100 µg/Vial

Anti-SKAR/POLDIP3 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
FOXA1 Antibody, HRP conjugated
A22199-100UG 100 µg

FOXA1 Antibody, HRP conjugated

Sign In for Pricing
View Details