Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q5PJT7

Expression Region

1-67

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cal-520FF™, potassium salt
21144-AAT 10x 50 µg

Cal-520FF™, potassium salt

Sign In for Pricing
View Details
Ac-Leu-Arg-AMC
TP1368-01 100 mg

Ac-Leu-Arg-AMC

Sign In for Pricing
View Details
Ac-Leu-Arg-AMC
TP1368-02 50 mg

Ac-Leu-Arg-AMC

Sign In for Pricing
View Details
FYCO1 (NM_024513) Human Mass Spec Standard
PH315323 10 µg

FYCO1 (NM_024513) Human Mass Spec Standard

Sign In for Pricing
View Details
Sodium Bicarbonate Buffer 1M, pH 9.0
41920126-3 500 mL

Sodium Bicarbonate Buffer 1M, pH 9.0

Sign In for Pricing
View Details
Fcrls (NM_030707) Mouse Tagged Lenti ORF Clone
MR208195L4 10 µg

Fcrls (NM_030707) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details