Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Protein AaeX (aaeX)

This Recombinant Salmonella paratyphi A Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q5PJT7

Expression Region

1-67

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Naa20 Pre-designed siRNA Set B
SI208990B 1 Each

Rat Naa20 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IKAROS Antibody
orb2671584-01 50 µL

IKAROS Antibody

Sign In for Pricing
View Details
IKAROS Antibody
orb2671584-02 100 µL

IKAROS Antibody

Sign In for Pricing
View Details
IKAROS Antibody
orb2671584-03 200 µL

IKAROS Antibody

Sign In for Pricing
View Details
Monkey Coiled coil domain containing protein 24 (CCDC24) ELISA kit
GTR10469997 96 Well

Monkey Coiled coil domain containing protein 24 (CCDC24) ELISA kit

Sign In for Pricing
View Details
Ankyrin B Rabbit Polyclonal Antibody (Cy7)
orb1035922 100 µL

Ankyrin B Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details