Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q665H0

Expression Region

1-67

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLD4, NT (PLD4, C14orf175, Phospholipase D4, Choline phosphatase 4, Phosphatidylcholine-hydrolyzing phospholipase D4) (APC) discontinued
040150-APC 200 µL

PLD4, NT (PLD4, C14orf175, Phospholipase D4, Choline phosphatase 4, Phosphatidylcholine-hydrolyzing phospholipase D4) (APC) discontinued

Sign In for Pricing
View Details
RPGR (NM_000328) Human Over-expression Lysate
LS006103-20ug 20 µg

RPGR (NM_000328) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human FGL2 Antibody (ABS0052)
ARO-A17548-01 50 µg

Anti-Human FGL2 Antibody (ABS0052)

Sign In for Pricing
View Details
Anti-Human FGL2 Antibody (ABS0052)
ARO-A17548-02 100 µg

Anti-Human FGL2 Antibody (ABS0052)

Sign In for Pricing
View Details
Anti-Human FGL2 Antibody (ABS0052)
ARO-A17548-03 1 mg

Anti-Human FGL2 Antibody (ABS0052)

Sign In for Pricing
View Details
Guinea pig ORM1-like 3 (S. cerevisiae) (ORMDL3) ELISA Kit
MBS2613132-01 48 Well

Guinea pig ORM1-like 3 (S. cerevisiae) (ORMDL3) ELISA Kit

Sign In for Pricing
View Details