Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q665H0

Expression Region

1-67

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D1 Protein Vector (Mouse) (pPB-C-His)
PV242202 500 ng

TSC22D1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Multi-Drug 6 Drugs Rapid Test
DSD-863-D 25 Tests

Multi-Drug 6 Drugs Rapid Test

Sign In for Pricing
View Details
2-[ (5,6-Dichloropyridin-3-yl) formamido]acetic acid
YTB38479-01 250 mg

2-[ (5,6-Dichloropyridin-3-yl) formamido]acetic acid

Sign In for Pricing
View Details
2-[ (5,6-Dichloropyridin-3-yl) formamido]acetic acid
YTB38479-02 2.5 g

2-[ (5,6-Dichloropyridin-3-yl) formamido]acetic acid

Sign In for Pricing
View Details
Flag Tag Recombinant Mouse mAb, PE-Cy7 conjugated
orb971124 100 µL

Flag Tag Recombinant Mouse mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Plasminogen Receptor Rabbit Polyclonal Antibody
APRab00646-01 20 µL

Plasminogen Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details