Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH)

This Recombinant Prochlorococcus marinus Photosystem II reaction center protein H (psbH) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Photosystem II reaction center protein H, PSII-H

UniProt

Q7VDT5

Expression Region

1-67

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQKTAVGSLLKSIGNSGQGKVVAGWGAVPVMAFVGVLLLVFLVILLQIYNQSLLLQGFS VDWNGVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF405S conjugate, 0.1mg/mL
BNC041041-500 1x 500 µL

TRIM29 (TRIM29/1041), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL
BNC740280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details