Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF10 (ORF10)

This Recombinant Spiroplasma virus SpV1-C74 Uncharacterized protein ORF10 (ORF10) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF10

UniProt

Q88426

Expression Region

1-67

Origin

Spiroplasma virus SpV1-C74 (SpV1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNDWQEFKEFFIYIFLFIDKANVESIIMWNLTQNEYLTLMVGVWVVILFLTWFFLWMVF KIVGYFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), CF594 conjugate, 0.1mg/mL
BNC940666-500 1x 500 µL

Cytokeratin 19 (BA17), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (BRA-11G), CF594 conjugate, 0.1mg/mL
BNC940174-500 1x 500 µL

CD45RB (BRA-11G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF594 conjugate, 0.1mg/mL
BNC942206-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (HSPD1/2206R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF740 conjugate, 0.1mg/mL
BNC740167-500 1x 500 µL

GFAP (GA-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details