Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8FD49

Expression Region

1-67

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P7 Protein Vector (Human) (pPB-N-His)
PV089983 500 ng

KRT8P7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Goat Immunoglobulin G (IgG) ELISA Kit
JL17405-01 48 Tests

Goat Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
Goat Immunoglobulin G (IgG) ELISA Kit
JL17405-02 96 Tests

Goat Immunoglobulin G (IgG) ELISA Kit

Sign In for Pricing
View Details
NDUFAF3 Protein Vector (Mouse) (pPM-C-HA)
31634024 500 ng

NDUFAF3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
6-CR6G, SE [6-Carboxyrhodamine 6G, succinimidyl ester] *Single isomer*
MBS8584861-01 5 mg

6-CR6G, SE [6-Carboxyrhodamine 6G, succinimidyl ester] *Single isomer*

Sign In for Pricing
View Details
6-CR6G, SE [6-Carboxyrhodamine 6G, succinimidyl ester] *Single isomer*
MBS8584861-02 5x 5 mg

6-CR6G, SE [6-Carboxyrhodamine 6G, succinimidyl ester] *Single isomer*

Sign In for Pricing
View Details