Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8FD49

Expression Region

1-67

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nras (NM_010937) Mouse Tagged Lenti ORF Clone
MR201859L4 10 µg

Nras (NM_010937) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CSRNP2 Rabbit Polyclonal Antibody (Biotin)
orb2086705 100 µL

CSRNP2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Canine Malondialdehyde (MDA) ELISA Kit-Sandwich
EK11F171-01 48 Test

Canine Malondialdehyde (MDA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Malondialdehyde (MDA) ELISA Kit-Sandwich
EK11F171-02 96 Tests

Canine Malondialdehyde (MDA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
FBXL2 Antibody Blocking peptide
orb1449287 500 µg

FBXL2 Antibody Blocking peptide

Sign In for Pricing
View Details
IDDM18 sgRNA CRISPR Lentivector (Human) (Target 1)
K1014402 1.0 µg DNA

IDDM18 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details