Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8XEK3

Expression Region

1-67

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium Sulfate Dihydrate
TRC-C145680-25G 25 g

Calcium Sulfate Dihydrate

Sign In for Pricing
View Details
RNPL1 Rabbit Polyclonal Antibody
JOT-AP04522-01 50ul

RNPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNPL1 Rabbit Polyclonal Antibody
JOT-AP04522-02 100ul

RNPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ITGAL Antibody
orb2679270-01 50 µL

ITGAL Antibody

Sign In for Pricing
View Details
ITGAL Antibody
orb2679270-02 100 µL

ITGAL Antibody

Sign In for Pricing
View Details
ITGAL Antibody
orb2679270-03 200 µL

ITGAL Antibody

Sign In for Pricing
View Details