Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8XEK3

Expression Region

1-67

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRMLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Photo-DL-lysine
HY-D2283 1 Each

Photo-DL-lysine

Sign In for Pricing
View Details
Anti-Interleukin-13 IL13 Antibody Fluoro550 Conjugated
RP1048-Fluoro550 100 µg/Vial

Anti-Interleukin-13 IL13 Antibody Fluoro550 Conjugated

Sign In for Pricing
View Details
Human GID4 Protein Lysate
MBS8412255-01 0.02 mg

Human GID4 Protein Lysate

Sign In for Pricing
View Details
Human GID4 Protein Lysate
MBS8412255-02 5x 0.02 mg

Human GID4 Protein Lysate

Sign In for Pricing
View Details
Mouse Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924704-01 48 Well

Mouse Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Sign In for Pricing
View Details
Mouse Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit
MBS9924704-02 96 Well

Mouse Disabled Homolog 2-Interacting Protein (DAB2IP) ELISA Kit

Sign In for Pricing
View Details