Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8RQS4

Expression Region

1-67

Origin

Serratia marcescens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPVFFELLVPLALFFLLRRLLQPTGIYDFVWHPALFNTALYCCLFY LISCLFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dhrs11 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4108403 1.0 µg DNA

Dhrs11 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Drosha (NM_001130149) Mouse Tagged ORF Clone Lentiviral Particle
MR227001L4V 200 µL

Drosha (NM_001130149) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Mouse S100A6, None tagged
MK0674M 10 µg

Recombinant Mouse S100A6, None tagged

Sign In for Pricing
View Details
MTGR1 Polyclonal Antibody, Cy5.5 Conjugated
bs-8304R-Cy5.5 100 µL

MTGR1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
CERS6 Peptide - C-terminal region (AAP75863)
AAP75863-100UG 100 µg

CERS6 Peptide - C-terminal region (AAP75863)

Sign In for Pricing
View Details
STFR E013-297x420-AL-CRD/1 AC Signs
815910 Card of 1 Pictogram(s)

STFR E013-297x420-AL-CRD/1 AC Signs

Sign In for Pricing
View Details