Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8ZAV0

Expression Region

1-67

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Alix Antibody (3A9) [DyLight 488]
NB100-65678G 0.1 mL

Mouse Monoclonal Alix Antibody (3A9) [DyLight 488]

Sign In for Pricing
View Details
APOBEC3C Rabbit Polyclonal Antibody (Fluoro647)
orb3100045 100 µg

APOBEC3C Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Protein (N-hFc, Mouse)
P516917 100 µg

Protein (N-hFc, Mouse)

Sign In for Pricing
View Details
3pK CRISPR Activation Plasmid (m)
sc-430437-ACT 20 µg

3pK CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Mouse Reticulon-1C / NSP-C Antibody
orb867226 0.1 mg

Mouse Reticulon-1C / NSP-C Antibody

Sign In for Pricing
View Details
Mouse Tbrg1 ELISA KIT
ELI-17389m 96 Tests

Mouse Tbrg1 ELISA KIT

Sign In for Pricing
View Details