Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8ZAV0

Expression Region

1-67

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC5 CRISPRa sgRNA lentivector (set of three targets)(Rat)
13331126 3x 1.0µg DNA

BIRC5 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Kinesin, Heavy Chain (APC)
MBS6268936-01 0.1 mL

Kinesin, Heavy Chain (APC)

Sign In for Pricing
View Details
Kinesin, Heavy Chain (APC)
MBS6268936-02 5x 0.1 mL

Kinesin, Heavy Chain (APC)

Sign In for Pricing
View Details
MDM1 (NM_020128) Human Tagged Lenti ORF Clone
RC221930L4 10 µg

MDM1 (NM_020128) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SCZD6 Protein Vector (Human) (pPM-C-HA)
43225021 500 ng

SCZD6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse CRABP2 Protein, His Tag
MOP1403-01 20 µg

Mouse CRABP2 Protein, His Tag

Sign In for Pricing
View Details