Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8ZAV0

Expression Region

1-67

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r32 sgRNA CRISPR Lentivector set (Rat)
K7149301 3x 1.0 µg

Vom2r32 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
OR6M2P Protein Vector (Human) (pPB-C-His)
PV108314 500 ng

OR6M2P Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
AATF (Apoptosis antagonizing transcription factor, CHE-1) (HRP)
330805-01 50 µg

AATF (Apoptosis antagonizing transcription factor, CHE-1) (HRP)

Sign In for Pricing
View Details
AATF (Apoptosis antagonizing transcription factor, CHE-1) (HRP)
330805-02 100 µg

AATF (Apoptosis antagonizing transcription factor, CHE-1) (HRP)

Sign In for Pricing
View Details
Cmk Recombinant Protein
OPCA02160-1MG 1 mg

Cmk Recombinant Protein

Sign In for Pricing
View Details
Human Protein Wnt-4 (WNT4) CLIA Kit
abx495972-01 96 Tests

Human Protein Wnt-4 (WNT4) CLIA Kit

Sign In for Pricing
View Details