Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein AaeX (aaeX)

This Recombinant Protein AaeX (aaeX) spans the amino acid sequence from region 1-67.

Product Specifications

Product Name Alternative

Protein AaeX

UniProt

Q8X9E0

Expression Region

1-67

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVCRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARID2 Protein Vector (Mouse) (pPM-C-HA)
PV156056 500 ng

ARID2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PTRH2 (Peptidyl-TRNA Hydrolase 2, BIT1, PTH2, CFAP37, CGI-147) (AP)
MBS6448769-01 0.1 mL

PTRH2 (Peptidyl-TRNA Hydrolase 2, BIT1, PTH2, CFAP37, CGI-147) (AP)

Sign In for Pricing
View Details
PTRH2 (Peptidyl-TRNA Hydrolase 2, BIT1, PTH2, CFAP37, CGI-147) (AP)
MBS6448769-02 5x 0.1 mL

PTRH2 (Peptidyl-TRNA Hydrolase 2, BIT1, PTH2, CFAP37, CGI-147) (AP)

Sign In for Pricing
View Details
CREG1 (Cellular Repressor of E1A-stimulated Genes 1, CREG 1, CREG, Protein CREG1, UNQ727/PRO1409)
125324 100 µg

CREG1 (Cellular Repressor of E1A-stimulated Genes 1, CREG 1, CREG, Protein CREG1, UNQ727/PRO1409)

Sign In for Pricing
View Details
CHI3L1 sgRNA CRISPR Lentivector set (Human)
K0444601 3x 1.0 µg

CHI3L1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ELISA kit for Human ART3 (Ecto-ADP-ribosyltransferase 3)
E-EL-H5627 96 Tests

ELISA kit for Human ART3 (Ecto-ADP-ribosyltransferase 3)

Sign In for Pricing
View Details