Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit F (mtrF)

This Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit F (mtrF) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit F, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F

UniProt

O27226

Expression Region

1-68

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIILSNKPNIRGIKRVVEDIKYRNQLIGRDGRLFAGLIATRISGIAIGFLLAVLLVGVPA MMSILGVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Daxx Antibody (PCRP-DAXX-8C2) [PerCP]
NBP3-08741PCP 100 µL

Mouse Monoclonal Daxx Antibody (PCRP-DAXX-8C2) [PerCP]

Sign In for Pricing
View Details
Herpes Simplex Virus I, Glycoprotein B (HSV I gB, Herpes Simplex Virus 1, HSV1) (APC) discontinued
H2033-07Y-APC 100 µL

Herpes Simplex Virus I, Glycoprotein B (HSV I gB, Herpes Simplex Virus 1, HSV1) (APC) discontinued

Sign In for Pricing
View Details
OR8K2P CRISPRa sgRNA lentivector (set of three targets)(Human)
35682121 3x 1.0µg DNA

OR8K2P CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Smarcc1 (SWI/SNF Complex Subunit SMARCC1, BRG1-Associated Factor 155, SWI/SNF Complex 155kD Subunit, SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily C Member 1, SWI3-Related Protein, BAF155, Smarcc1, Baf155, Srg3) (MaxLight 405) discontinued
302756-ML405 100 µL

Smarcc1 (SWI/SNF Complex Subunit SMARCC1, BRG1-Associated Factor 155, SWI/SNF Complex 155kD Subunit, SWI/SNF-Related Matrix-Associated Actin-Dependent Regulator of Chromatin Subfamily C Member 1, SWI3-Related Protein, BAF155, Smarcc1, Baf155, Srg3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CEACAM5 Antibody
orb2308850-01 50 µL

CEACAM5 Antibody

Sign In for Pricing
View Details
CEACAM5 Antibody
orb2308850-02 100 µL

CEACAM5 Antibody

Sign In for Pricing
View Details