Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q49Z55

Expression Region

1-68

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGIGLVEALPIIG VVIAFMSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR125 Blocking Peptide
MBS822531-01 1 mg

GPR125 Blocking Peptide

Sign In for Pricing
View Details
GPR125 Blocking Peptide
MBS822531-02 5 mg

GPR125 Blocking Peptide

Sign In for Pricing
View Details
GPR125 Blocking Peptide
MBS822531-03 5x 5 mg

GPR125 Blocking Peptide

Sign In for Pricing
View Details
Rat RPL35 siRNA
abx931964-01 15 nmol

Rat RPL35 siRNA

Sign In for Pricing
View Details
Rat RPL35 siRNA
abx931964-02 30 nmol

Rat RPL35 siRNA

Sign In for Pricing
View Details
Recombinant Clostridium Novyi NT01CX_1282 Protein (aa 1-244)
VAng-Lsx00042-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Novyi NT01CX_1282 Protein (aa 1-244)

Sign In for Pricing
View Details