Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit c (atpE)
This Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-68.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q49Z55
Expression Region
1-68
Origin
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGIGLVEALPIIG VVIAFMSL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP310721M 100 µg
WW domain binding protein 4 (WBP4) (NM_007187) Human Recombinant Protein
Sign In for Pricing
View Details 
MBS6464000-01 0.2 mL
ARK5, CT (NUAK Family SNF1-like Kinase 1, AMPK-related Protein Kinase 5, KIAA0537, NUAK1) (AP)
Sign In for Pricing
View Details MBS6464000-02 5x 0.2 mL
ARK5, CT (NUAK Family SNF1-like Kinase 1, AMPK-related Protein Kinase 5, KIAA0537, NUAK1) (AP)
Sign In for Pricing
View Details