Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit F (mtrF)

This Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit F (mtrF) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit F, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit F

UniProt

Q58262

Expression Region

1-68

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVEVSNKPNVSSIQSYVEDLEYKVGLITRNRGLESGTESAGTKGLIIGVVSAIVLMGIP LALYFLMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vortex Mixer BVMX-104
BVMX-104 1 Unit

Vortex Mixer BVMX-104

Sign In for Pricing
View Details
MEK1 (MAP2K1) Rabbit Polyclonal Antibody
AP02714PU-S 50 µL

MEK1 (MAP2K1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phloroacetophenone 4-Neohesperidoside
TRC-P127235-500MG 500 mg

Phloroacetophenone 4-Neohesperidoside

Sign In for Pricing
View Details
Renin (REN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E4]
TA807107AM 100 µL

Renin (REN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E4]

Sign In for Pricing
View Details
P4HA3 (NM_182904) Human Over-expression Lysate
LC403649 20 µg

P4HA3 (NM_182904) Human Over-expression Lysate

Sign In for Pricing
View Details
Solution Reservoir
P7005 300 Units/Case

Solution Reservoir

Sign In for Pricing
View Details