Recombinant Oceanobacillus iheyensis ATP synthase subunit c (atpE)
This Recombinant Oceanobacillus iheyensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-68.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q8EM78
Expression Region
1-68
Origin
Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGALAAAIAIGLAALGAGLGNGMIVSKTVEGIARQPELRGALQGTMFIGVALVEAIPIIA AVIAFMVM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2730-500 1x 500 µL
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2742-100 1x 100 µL
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2742), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 