Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML2453 (ML2453)

This Recombinant Uncharacterized protein ML2453 (ML2453) spans the amino acid sequence from region 20-87.

Product Specifications

Product Name Alternative

Uncharacterized protein ML2453

UniProt

Q9CB43

Expression Region

20-87

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALQRPDAYTAAEKLTKPVWLVILGAAVSLTSILGFVFGVLGIVIAACAAGVYLVDVRPKL LDIQGKSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ltn1 Mouse qPCR Primer Pair (NM_001081068)
MP218801 200 Reactions

Ltn1 Mouse qPCR Primer Pair (NM_001081068)

Sign In for Pricing
View Details
LTA4H Antibody
GWB-MT347E 50 µg

LTA4H Antibody

Sign In for Pricing
View Details
Nortracheloside
AB2751 10 mg

Nortracheloside

Sign In for Pricing
View Details
Canine MTF ELISA Kit
ECM0353 96 Tests

Canine MTF ELISA Kit

Sign In for Pricing
View Details
Prolactin, Recombinant, Human (Luterotropic Hormone, Lutetropin, Mammotropin, PRL) discontinued
500411 50 µg

Prolactin, Recombinant, Human (Luterotropic Hormone, Lutetropin, Mammotropin, PRL) discontinued

Sign In for Pricing
View Details
NTS siRNA (Human)
CRH3272-01 15 nmol

NTS siRNA (Human)

Sign In for Pricing
View Details