Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML2453 (ML2453)

This Recombinant Uncharacterized protein ML2453 (ML2453) spans the amino acid sequence from region 20-87.

Product Specifications

Product Name Alternative

Uncharacterized protein ML2453

UniProt

Q9CB43

Expression Region

20-87

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALQRPDAYTAAEKLTKPVWLVILGAAVSLTSILGFVFGVLGIVIAACAAGVYLVDVRPKL LDIQGKSR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apoptosis repressor with CARD (NOL3) (NM_003946) Human Tagged ORF Clone
RG200591 10 µg

Apoptosis repressor with CARD (NOL3) (NM_003946) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-A2LD1 Antibody
39425 100 µL

Anti-A2LD1 Antibody

Sign In for Pricing
View Details
phospho-STAT6 (Tyr641) Polyclonal Antibody Bio Conjugated
MBS9463052-01 0.1 mL

phospho-STAT6 (Tyr641) Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
phospho-STAT6 (Tyr641) Polyclonal Antibody Bio Conjugated
MBS9463052-02 5x 0.1 mL

phospho-STAT6 (Tyr641) Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
KAP2 Antibody
E19-3091 100 µg -100 µL

KAP2 Antibody

Sign In for Pricing
View Details
Recombinant Brucella ovis Protein TolB (tolB)
MBS1170865-01 0.02 mg (E-Coli)

Recombinant Brucella ovis Protein TolB (tolB)

Sign In for Pricing
View Details