Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Negative regulatory protein yxlD (yxlD)

This Recombinant Bacillus subtilis Negative regulatory protein yxlD (yxlD) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

Negative regulatory protein yxlD

UniProt

P94372

Expression Region

1-68

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQTEIIITVAACLIVLAQGIFLFIDAKKRNHMAWVWGIVGLIQAPMPLICYYFFVIRPD RKKRGIKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kappa Light Chain Rat Monoclonal Antibody [Clone ID: 187.1]
AM08019FC-S 100 µg

Mouse Kappa Light Chain Rat Monoclonal Antibody [Clone ID: 187.1]

Sign In for Pricing
View Details
2-Bromopropionyl Chloride
TRC-B687850-1G 1 g

2-Bromopropionyl Chloride

Sign In for Pricing
View Details
Rhotekin 2 (RTKN2) Rabbit Polyclonal Antibody
TA366216 100 µL

Rhotekin 2 (RTKN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-1629-01 50 μL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-1629-02 100 µL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details
Carcino Embryonic Antigen CEA (CD66e) Antibody
KC-1629-03 1 mL

Carcino Embryonic Antigen CEA (CD66e) Antibody

Sign In for Pricing
View Details