Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Negative regulatory protein yxlD (yxlD)

This Recombinant Bacillus subtilis Negative regulatory protein yxlD (yxlD) spans the amino acid sequence from region 1-68.

Product Specifications

Product Name Alternative

Negative regulatory protein yxlD

UniProt

P94372

Expression Region

1-68

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQTEIIITVAACLIVLAQGIFLFIDAKKRNHMAWVWGIVGLIQAPMPLICYYFFVIRPD RKKRGIKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Glutathione S-transferase Assay Kit
DGST-100 100 Tests

QuantiChrom™ Glutathione S-transferase Assay Kit

Sign In for Pricing
View Details
Zscan22 Mouse Gene Knockout Kit (CRISPR)
KN520152 1 Kit

Zscan22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Tie2/CD202b Protein (His Tag)
PKSH031472-01 100 µg

Recombinant Human Tie2/CD202b Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Tie2/CD202b Protein (His Tag)
PKSH031472-02 1 mg

Recombinant Human Tie2/CD202b Protein (His Tag)

Sign In for Pricing
View Details
Keratin 36 (KRT36) Rabbit Polyclonal Antibody
TA372856 100 µL

Keratin 36 (KRT36) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human KHDC4 activation kit by CRISPRa
GA107886 1 Kit

Human KHDC4 activation kit by CRISPRa

Sign In for Pricing
View Details