Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pilin (traA)

This Recombinant Pilin (traA) spans the amino acid sequence from region 52-119.

Product Specifications

Product Name Alternative

Pilin

UniProt

P14495

Expression Region

52-119

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AQGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIA VGMAVVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TMPRSS4 Protein, N-His
orb2967245-01 50 µg

Recombinant Human TMPRSS4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TMPRSS4 Protein, N-His
orb2967245-02 100 µg

Recombinant Human TMPRSS4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TMPRSS4 Protein, N-His
orb2967245-03 1 mg

Recombinant Human TMPRSS4 Protein, N-His

Sign In for Pricing
View Details
Embigin Rabbit pAb, PE-Cy7 conjugated
orb2877556 100 µL

Embigin Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
S20 Nom Kine/Dyna Viscosity Density Std
REVIS-S20 500 mL

S20 Nom Kine/Dyna Viscosity Density Std

Sign In for Pricing
View Details
P2X Antagonist III (Purinergic Receptor P2X Antagonist III, N- ((4- (4-Phenylpiperazin-1-yl) tetrahydro-2H-pyran-4-yl) methyl) -2- (phenylthio) nicotinamide) discontinued. see 255565
217614 10 mg

P2X Antagonist III (Purinergic Receptor P2X Antagonist III, N- ((4- (4-Phenylpiperazin-1-yl) tetrahydro-2H-pyran-4-yl) methyl) -2- (phenylthio) nicotinamide) discontinued. see 255565

Sign In for Pricing
View Details