Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pilin (traA)

This Recombinant Pilin (traA) spans the amino acid sequence from region 52-119.

Product Specifications

Product Name Alternative

Pilin

UniProt

P14495

Expression Region

52-119

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AQGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIA VGMAVVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor 145 (VEGF145) BioAssayTM ELISA Kit (Human) discontinued
028825-01 48 Tests

Vascular Endothelial Growth Factor 145 (VEGF145) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor 145 (VEGF145) BioAssayTM ELISA Kit (Human) discontinued
028825-02 96 Tests

Vascular Endothelial Growth Factor 145 (VEGF145) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Smoc2 shRNA (UAS) - Lentiviral mouse Smoc2 shRNA (UAS, iRFP) (100)
GTR15186531 1 Vial

Lentiviral mouse Smoc2 shRNA (UAS) - Lentiviral mouse Smoc2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-NDFIP2 Antibody Picoband® (monoclonal, 10D6D7)-FITC Conjugate
M08384-FITC 100 µg/Vial

Anti-NDFIP2 Antibody Picoband® (monoclonal, 10D6D7)-FITC Conjugate

Sign In for Pricing
View Details
METTL20 Polyclonal Antibody
MBS2566660-01 0.06 mL

METTL20 Polyclonal Antibody

Sign In for Pricing
View Details
METTL20 Polyclonal Antibody
MBS2566660-02 0.12 mL

METTL20 Polyclonal Antibody

Sign In for Pricing
View Details