Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit c (atpE)

This Recombinant Nocardioides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SHI6

Expression Region

1-69

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIEGSANMIGYGLAAIGPGVGIGLIFAAYISGVARQPEAQSRLQAIAILGFALAEALAI IGIALAFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF13 Antibody
orb679154 100 µL

KLF13 Antibody

Sign In for Pricing
View Details
Cyclin E1 Antibody
MBS9503489-01 0.05 mL

Cyclin E1 Antibody

Sign In for Pricing
View Details
Cyclin E1 Antibody
MBS9503489-02 0.1 mL

Cyclin E1 Antibody

Sign In for Pricing
View Details
Cyclin E1 Antibody
MBS9503489-03 5x 0.1 mL

Cyclin E1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD43/Sialophorin Antibody (290111) [DyLight 350]
FAB2038D 0.1 mL

Mouse Monoclonal CD43/Sialophorin Antibody (290111) [DyLight 350]

Sign In for Pricing
View Details
Human WDCP Knockout HEK293T cell line
GTR15408314 1 Vial

Human WDCP Knockout HEK293T cell line

Sign In for Pricing
View Details