Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit c (atpE)

This Recombinant Nocardioides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SHI6

Expression Region

1-69

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIEGSANMIGYGLAAIGPGVGIGLIFAAYISGVARQPEAQSRLQAIAILGFALAEALAI IGIALAFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)
MBS6151212-01 0.1 mL

ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)

Sign In for Pricing
View Details
ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)
MBS6151212-02 5x 0.1 mL

ANKS1A (Ankyrin Repeat and SAM Domain-containing Protein 1A, Odin, ANKS1, KIAA0229, ODIN) (HRP)

Sign In for Pricing
View Details
DL1000 Ladder
MD1116 1.25 mL

DL1000 Ladder

Sign In for Pricing
View Details
Cholesteryl N- (trimethylammonioethyl) carbamate chloride
orb2939083-01 100 mg

Cholesteryl N- (trimethylammonioethyl) carbamate chloride

Sign In for Pricing
View Details
Cholesteryl N- (trimethylammonioethyl) carbamate chloride
orb2939083-02 50 mg

Cholesteryl N- (trimethylammonioethyl) carbamate chloride

Sign In for Pricing
View Details
Cholesteryl N- (trimethylammonioethyl) carbamate chloride
orb2939083-03 250 mg

Cholesteryl N- (trimethylammonioethyl) carbamate chloride

Sign In for Pricing
View Details