Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nocardioides sp. ATP synthase subunit c (atpE)

This Recombinant Nocardioides sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SHI6

Expression Region

1-69

Origin

Nocardioides sp. (strain BAA-499 / JS614)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIEGSANMIGYGLAAIGPGVGIGLIFAAYISGVARQPEAQSRLQAIAILGFALAEALAI IGIALAFVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIP3 shRNA Plasmid (h)
sc-97205-SH 20 µg

CLIP3 shRNA Plasmid (h)

Sign In for Pricing
View Details
SPT16 Antibody
C11966-01 50 μL

SPT16 Antibody

Sign In for Pricing
View Details
SPT16 Antibody
C11966-02 100 µL

SPT16 Antibody

Sign In for Pricing
View Details
Human Cluster Of Differentiation 7 (CD7) ELISA Kit
QY-E05057 96 Tests

Human Cluster Of Differentiation 7 (CD7) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Haptoglobin Antibody (HP/4813) [Alexa Fluor 750]
NBP3-26948AF750 0.1 mL

Mouse Monoclonal Haptoglobin Antibody (HP/4813) [Alexa Fluor 750]

Sign In for Pricing
View Details
MASPIN (SERPINB5) (NM_002639) Human Recombinant Protein
TP324287L 1 mg

MASPIN (SERPINB5) (NM_002639) Human Recombinant Protein

Sign In for Pricing
View Details