Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Skeletonema costatum Probable protein-export membrane protein secG (secG)

This Recombinant Skeletonema costatum Probable protein-export membrane protein secG (secG) spans the amino acid sequence from region 1-69.

Product Specifications

Product Name Alternative

Probable protein-export membrane protein secG

UniProt

O96799

Expression Region

1-69

Origin

Skeletonema costatum (Marine centric diatom)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKIIWVILSIVLIGLIFLRTPQNQGLASFSTKSNLLGSPSSAEQFLNNLTIILMIGYFS FAVFLNFSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS41 Protein Vector (Human) (pPM-C-His)
PV045892 500 ng

VPS41 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein
abx166241-01 10 µg

Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein

Sign In for Pricing
View Details
Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein
abx166241-02 50 µg

Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein

Sign In for Pricing
View Details
Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein
abx166241-03 100 µg

Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein

Sign In for Pricing
View Details
Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein
abx166241-04 200 µg

Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein

Sign In for Pricing
View Details
Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein
abx166241-05 500 µg

Human KH Domain Containing, RNA Binding, Signal Transduction Associated Protein 1 (KHDRBS1) Protein

Sign In for Pricing
View Details