Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Type IV secretion system protein virB2 (virB2)

This Recombinant Brucella abortus Type IV secretion system protein virB2 (virB2) spans the amino acid sequence from region 37-105.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB2

UniProt

Q2YIT6

Expression Region

37-105

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF114 Protein Vector (Human) (pPM-C-His)
PV060028 500 ng

ZNF114 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit-Sandwich
EK6F547-01 48 Test

Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit-Sandwich
EK6F547-02 96 Tests

Mouse Defensin Alpha 6, Paneth Cell Specific (DEFa6) ELISA Kit-Sandwich

Sign In for Pricing
View Details
WT1 (D6M6S) Rabbit Monoclonal Antibody
CST 13580S 100 µL

WT1 (D6M6S) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cdk5r1-set siRNA/shRNA/RNAi Lentivector (Mouse)
15708094 4x 500 ng

Cdk5r1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Anti-PRPF8 Antibody (R2M84)
RHK69001 100 μg

Anti-PRPF8 Antibody (R2M84)

Sign In for Pricing
View Details