Recombinant Bordetella pertussis Type IV secretion system protein ptlA (ptlA)
This Recombinant Bordetella pertussis Type IV secretion system protein ptlA (ptlA) spans the amino acid sequence from region 34-102.
Product Specifications
Product Name Alternative
Type IV secretion system protein ptlA, Pertussis toxin liberation protein A
UniProt
Q45390
Expression Region
34-102
Origin
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA750849 100 µL
Alpha Tubulin Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
