Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Type IV secretion system protein ptlA (ptlA)

This Recombinant Bordetella pertussis Type IV secretion system protein ptlA (ptlA) spans the amino acid sequence from region 34-102.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlA, Pertussis toxin liberation protein A

UniProt

Q45390

Expression Region

34-102

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin 1 (CAV1) (C-term) Rabbit Polyclonal Antibody
AP31042PU-N 250 µL

Caveolin 1 (CAV1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plasma/Serum Cell-Free Circulating and Viral Nucleic Acid Purification Maxi Kit
56500 10 Preparations

Plasma/Serum Cell-Free Circulating and Viral Nucleic Acid Purification Maxi Kit

Sign In for Pricing
View Details
ATP2C1 Polyclonal Antibody
E-AB-10988-01 20 µL

ATP2C1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP2C1 Polyclonal Antibody
E-AB-10988-02 60 µL

ATP2C1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP2C1 Polyclonal Antibody
E-AB-10988-03 120 µL

ATP2C1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP2C1 Polyclonal Antibody
E-AB-10988-04 200 µL

ATP2C1 Polyclonal Antibody

Sign In for Pricing
View Details