Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type IV secretion system protein ptlA homolog (ptlA)

This Recombinant Type IV secretion system protein ptlA homolog (ptlA) spans the amino acid sequence from region 34-102.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlA homolog

UniProt

Q7W2U5

Expression Region

34-102

Origin

Bordetella parapertussis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR Purification Kit-250p
45700 250 Preparations

PCR Purification Kit-250p

Sign In for Pricing
View Details
Recombinant LIN9 Antibody
RN-12404-01 50 μL

Recombinant LIN9 Antibody

Sign In for Pricing
View Details
Recombinant LIN9 Antibody
RN-12404-02 100 µL

Recombinant LIN9 Antibody

Sign In for Pricing
View Details
Recombinant LIN9 Antibody
RN-12404-03 1 mL

Recombinant LIN9 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS803910 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
PUR-1
17560-AAT 1 mg

PUR-1

Sign In for Pricing
View Details