Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type IV secretion system protein ptlA homolog (ptlA)

This Recombinant Type IV secretion system protein ptlA homolog (ptlA) spans the amino acid sequence from region 34-102.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlA homolog

UniProt

Q7W2U5

Expression Region

34-102

Origin

Bordetella parapertussis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stat5b Mouse Gene Knockout Kit (CRISPR)
KN516848 1 Kit

Stat5b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Proteasome subunit beta type 4 (PSMB4) Goat Polyclonal Antibody
AP32717PU-N 100 µg

Proteasome subunit beta type 4 (PSMB4) Goat Polyclonal Antibody

Sign In for Pricing
View Details
EnzyChrom™ Nitric Oxide Synthase Assay Kit
ENOS-100 100 Tests

EnzyChrom™ Nitric Oxide Synthase Assay Kit

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), CF647 conjugate, 0.1mg/mL
BNC473350-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3350), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1H,1H,6H-Decafluorohexan-1-ol
TRC-D210625-500MG 500 mg

1H,1H,6H-Decafluorohexan-1-ol

Sign In for Pricing
View Details
Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein
TP307432 20 µg

Cytochrome P450 3A5 (CYP3A5) (NM_000777) Human Recombinant Protein

Sign In for Pricing
View Details