Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type IV secretion system protein ptlA homolog (ptlA)

This Recombinant Type IV secretion system protein ptlA homolog (ptlA) spans the amino acid sequence from region 34-102.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlA homolog

UniProt

Q7W2U5

Expression Region

34-102

Origin

Bordetella parapertussis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGGLQRVNHFMASIVVVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIGAS AEIARYLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Hydroxy Aminopterin
TRC-H797250-5MG 5 mg

7-Hydroxy Aminopterin

Sign In for Pricing
View Details
PTDSS2 Human Gene Knockout Kit (CRISPR)
KN200996LP 1 Kit

PTDSS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®790 Conjugate
#29147 1x 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®790 Conjugate

Sign In for Pricing
View Details
BHMT2 (NM_001178005) Human Over-expression Lysate
LY432850 100 µg

BHMT2 (NM_001178005) Human Over-expression Lysate

Sign In for Pricing
View Details
SFRS17A (AKAP17A) (Center) Rabbit Polyclonal Antibody
AP53878PU-N 400 µL

SFRS17A (AKAP17A) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Hydroxyphenylacetaldehyde, approximately ~15% wt/vol in Ethyl Acetate
TRC-H949050-50MG 50 mg

4-Hydroxyphenylacetaldehyde, approximately ~15% wt/vol in Ethyl Acetate

Sign In for Pricing
View Details