Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2)

This Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2) spans the amino acid sequence from region 37-105.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB2

UniProt

Q7CEG0

Expression Region

37-105

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRKD2/PKD2 Protein (His & GST Tag)
PKSH030353 50 µg

Recombinant Human PRKD2/PKD2 Protein (His & GST Tag)

Sign In for Pricing
View Details
CYB5R2 (NM_001302827) Human Tagged ORF Clone
RG236751 10 µg

CYB5R2 (NM_001302827) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD166 (ALCAM) Mouse Monoclonal Antibody [Clone ID: 10F1G12]
AM06247SU-N 100 µL

CD166 (ALCAM) Mouse Monoclonal Antibody [Clone ID: 10F1G12]

Sign In for Pricing
View Details
E2F1 Human Gene Knockout Kit (CRISPR)
KN208247BN 1 Kit

E2F1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody
AP23642PU-N 50 µL

Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS
MGW08F-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - White PS

Sign In for Pricing
View Details