Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2)

This Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2) spans the amino acid sequence from region 37-105.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB2

UniProt

Q7CEG0

Expression Region

37-105

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cholera Toxin B, CF®532 Conjugate, 100 ug
#00074 1x 100 µg

Cholera Toxin B, CF®532 Conjugate, 100 ug

Sign In for Pricing
View Details
PTPRJ Polyclonal Antibody
E-AB-65741-01 60 µL

PTPRJ Polyclonal Antibody

Sign In for Pricing
View Details
PTPRJ Polyclonal Antibody
E-AB-65741-02 120 µL

PTPRJ Polyclonal Antibody

Sign In for Pricing
View Details
PTPRJ Polyclonal Antibody
E-AB-65741-03 200 µL

PTPRJ Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), 0.2mg/mL
BNUB2481-100 1x 100 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), 0.2mg/mL

Sign In for Pricing
View Details
Human GCP6 (TUBGCP6) activation kit by CRISPRa
GA113866 1 Kit

Human GCP6 (TUBGCP6) activation kit by CRISPRa

Sign In for Pricing
View Details