Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2)

This Recombinant Brucella suis biovar 1 Type IV secretion system protein virB2 (virB2) spans the amino acid sequence from region 37-105.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB2

UniProt

Q7CEG0

Expression Region

37-105

Origin

Brucella suis biovar 1 (strain 1330)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSGYKMAFRHARFMDVVPVLGGALVVGAA AEIASYLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP4 (NM_001164356) Human Over-expression Lysate
LC431127 20 µg

THAP4 (NM_001164356) Human Over-expression Lysate

Sign In for Pricing
View Details
MARCHF6 Human Gene Knockout Kit (CRISPR)
KN422261 1 Kit

MARCHF6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS509710 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Rara Mouse Gene Knockout Kit (CRISPR)
KN514481 1 Kit

Rara Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB638378 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
TNFSF18 Rabbit Polyclonal Antibody
TA367580 100 µL

TNFSF18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details