Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein yaiZ (yaiZ)

This Recombinant Escherichia coli Uncharacterized protein yaiZ (yaiZ) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

Uncharacterized protein yaiZ

UniProt

P0AAQ0

Expression Region

1-70

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR RRDEETENAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Human Coronavirus Spike Protein Antibody (07) [Alexa Fluor 594]
NBP3-06647AF594 0.1 mL

Mouse Monoclonal Human Coronavirus Spike Protein Antibody (07) [Alexa Fluor 594]

Sign In for Pricing
View Details
Gm4307 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3085102 1.0 µg DNA

Gm4307 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal PLA2G3 Antibody
NBP1-83367 0.1 mL

Rabbit Polyclonal PLA2G3 Antibody

Sign In for Pricing
View Details
Recombinant Human LRRC46 Protein
E30P8908 20 µg

Recombinant Human LRRC46 Protein

Sign In for Pricing
View Details
Acid Blue 120
orb1987434-01 100 mg

Acid Blue 120

Sign In for Pricing
View Details
Acid Blue 120
orb1987434-02 50 mg

Acid Blue 120

Sign In for Pricing
View Details