Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein N (GN)

This Recombinant Epstein-Barr virus Glycoprotein N (GN) spans the amino acid sequence from region 33-102.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P03196

Expression Region

33-102

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasd1 3'UTR Lenti-reporter-Luc Vector
38532086 1.0 µg

Rasd1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FAM91A3P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0737305 3x 1.0 µg

FAM91A3P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Intestinal Fibroblasts
RPC-407 5x 10^5

Mouse Intestinal Fibroblasts

Sign In for Pricing
View Details
Myf-6 (G-7) Alexa Fluor® 488
sc-514379 AF488 200 µg/mL

Myf-6 (G-7) Alexa Fluor® 488

Sign In for Pricing
View Details
Goose Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit
MBS9922797 Inquire

Goose Pygopus Homolog 2 (PYGO2/PP7910) ELISA Kit

Sign In for Pricing
View Details
Med15 Antibody (C-term)
orb1926552-01 50 µL

Med15 Antibody (C-term)

Sign In for Pricing
View Details