Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein N (GN)

This Recombinant Epstein-Barr virus Glycoprotein N (GN) spans the amino acid sequence from region 33-102.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P03196

Expression Region

33-102

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EPHA7 Antibody
STJ500924 100 µg

Anti-EPHA7 Antibody

Sign In for Pricing
View Details
POLDIP2 Peptide - N-terminal region
MBS3247315-01 0.1 mg

POLDIP2 Peptide - N-terminal region

Sign In for Pricing
View Details
POLDIP2 Peptide - N-terminal region
MBS3247315-02 5x 0.1 mg

POLDIP2 Peptide - N-terminal region

Sign In for Pricing
View Details
Ecosurf™ EH-9 for biochemistry
2325ML500 500 mL

Ecosurf™ EH-9 for biochemistry

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FPF1 Polyclonal Antibody
MBS9000663 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FPF1 Polyclonal Antibody

Sign In for Pricing
View Details
Ddc8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
17773116 3x 1.0 µg

Ddc8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details