Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Glycoprotein N (GN)

This Recombinant Epstein-Barr virus Glycoprotein N (GN) spans the amino acid sequence from region 33-102.

Product Specifications

Product Name Alternative

Glycoprotein N, gN

UniProt

P03196

Expression Region

33-102

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF106 knockdown cell line
ABC-KD17361 1 Vial

Human ZNF106 knockdown cell line

Sign In for Pricing
View Details
Pseudomonas PP Supplement
81093 10 Vials

Pseudomonas PP Supplement

Sign In for Pricing
View Details
Natural Cytotoxicity Triggering Receptor 1 (NCR1) Antibody (PE)
abx414082 100 Tests

Natural Cytotoxicity Triggering Receptor 1 (NCR1) Antibody (PE)

Sign In for Pricing
View Details
Human Amyloid Beta 40 ELISA Kit
MBS760432-01 48 Well

Human Amyloid Beta 40 ELISA Kit

Sign In for Pricing
View Details
Human Amyloid Beta 40 ELISA Kit
MBS760432-02 96 Well

Human Amyloid Beta 40 ELISA Kit

Sign In for Pricing
View Details
Human Amyloid Beta 40 ELISA Kit
MBS760432-03 5x 96 Well

Human Amyloid Beta 40 ELISA Kit

Sign In for Pricing
View Details