Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yaiZ (yaiZ)

This Recombinant Uncharacterized protein yaiZ (yaiZ) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

Uncharacterized protein yaiZ

UniProt

P0AAQ1

Expression Region

1-70

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR RRDEETENAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPN2 Antibody
MBS9430081-01 0.1 mL

GPN2 Antibody

Sign In for Pricing
View Details
GPN2 Antibody
MBS9430081-02 5x 0.1 mL

GPN2 Antibody

Sign In for Pricing
View Details
MyeloperOxidase/MPO) Mouse ELISA Kit
F1711 96 Tests

MyeloperOxidase/MPO) Mouse ELISA Kit

Sign In for Pricing
View Details
(S) -3-Amino-2-pyrrolidinone
EAA12800 2.5 g

(S) -3-Amino-2-pyrrolidinone

Sign In for Pricing
View Details
Anti-Notch1 Monoclonal Antibody, Carrier-free
M00033-carrier-free 100 µL

Anti-Notch1 Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
Recombinant Streptococcus suis ssnA Protein, N-His
orb2962370-01 50 µg

Recombinant Streptococcus suis ssnA Protein, N-His

Sign In for Pricing
View Details